Rule34 Scroller

Post #15311849

3428 × 2419
2025, 2d, 5 fingers, 5 toes, 5girls, absurd res, adult on young, afrosoricid, age difference, anthro, anthro on anthro, areola, back wings, badger, bandeau, bat, big breasts, bikini, bikini aside, bikini bralette, biped, black text, blindfold, bodily fluids, boomerang, bottomwear, bra, bracelet, breast size difference, breast sucking, breasts, casual nudity, closed smile, clothed, clothed anthro, clothed female, clothing, clothing aside, collarbone, covering, covering breasts, cream the rabbit, crocs, cub, daughter (lore), dialogue, disappointed, drockdraw, drooling, duo, ear piercing, ear ring, english text, eye contact, eyelashes, eyemask, eyewear, feet, female, female anthro, female only, female/female, finger fuck, fingering, fingering partner, fingers, flat chest, flat chested, floppy ears, floral print, flying, footwear, fur, genitals, gloves, greyscale, group, hair, half-closed eyes, hand on shoulder, handwear, happy, hat, headgear, headpat, headwear, hi res, holding bra, holding clothing, holding object, holding panties, holding underwear, hug, humanoid feet, humanoid genitalia, humanoid hands, humanoid vulva, idw comics, idw publishing, illuminati, interspecies, jacket, jewelry, lagomorph, leporid, lips, looking aside, looking at another, looking at breasts, looking down, looking down at another, looking up at another, lop ears, lying, mammal, mask, membrane (anatomy), membranous wings, midriff, mobian, mobian (species), mobian tenrec, monochrome, mother (lore), mother and daughter (lore), mouth closed, multiple females, multiple girls, multiple images, mustelid, musteline, narrowed eyes, navel, nipple fetish, nipple play, nipple suck, nipples, nude, nude anthro, nude female, nudist, on back, open mouth, open smile, panties, pants, parent (lore), parent and daughter (lore), piercing, plantigrade, pubes, pussy, rabbit, reclining, ribs, ring piercing, rouge the bat, saliva, sandals, sega, sequence, shirt, shoes, short hair, shorts, size difference, sketch page, skinny anthro, skinny female, sleep mask, sleeping, smile, sneakers, solo, sonic (series), sonic boom, sonic the hedgehog (comics), sonic the hedgehog (idw), sonic the hedgehog (series), spandex, spandex shorts, spiked bracelet, spikes, standing, sticks the badger, sticks the jungle badger, sucking, surge the tenrec, swimwear, swimwear aside, t-shirt, talking to another, tank top, tenrec, text, tight bottomwear, tight clothing, tight shorts, toes, tongue, topwear, triangle bikini, trio, two-piece swimsuit, underwear, vaginal penetration, vanilla the rabbit, visor cap, vulva, wide eyed, wings, young, young anthro, young female
97
Original Download Source

Artists

drockdraw

Characters

cream the rabbitmobian (species)rouge the batsticks the badgersticks the jungle badgersurge the tenrecvanilla the rabbit

Copyrights

idw comicsidw publishingsegasonic (series)sonic boomsonic the hedgehog (comics)sonic the hedgehog (idw)sonic the hedgehog (series)

Metadata

20252dabsurd resdialogueenglish textgreyscalehi resmonochromemultiple imagessequencetext

Tags

5 fingers5 toes5girlsadult on youngafrosoricidage differenceanthroanthro on anthroareolaback wingsbadgerbandeaubatbig breastsbikinibikini asidebikini bralettebipedblack textblindfoldbodily fluidsboomerangbottomwearbrabraceletbreast size differencebreast suckingbreastscasual nudityclosed smileclothedclothed anthroclothed femaleclothingclothing asidecollarbonecoveringcovering breastscrocscubdaughter (lore)disappointeddroolingduoear piercingear ringeye contacteyelasheseyemaskeyewearfeetfemalefemale anthrofemale onlyfemale/femalefinger fuckfingeringfingering partnerfingersflat chestflat chestedfloppy earsfloral printflyingfootwearfurgenitalsglovesgrouphairhalf-closed eyeshand on shoulderhandwearhappyhatheadgearheadpatheadwearholding braholding clothingholding objectholding pantiesholding underwearhughumanoid feethumanoid genitaliahumanoid handshumanoid vulvailluminatiinterspeciesjacketjewelrylagomorphleporidlipslooking asidelooking at anotherlooking at breastslooking downlooking down at anotherlooking up at anotherlop earslyingmammalmaskmembrane (anatomy)membranous wingsmidriffmobianmobian tenrecmother (lore)mother and daughter (lore)mouth closedmultiple femalesmultiple girlsmustelidmustelinenarrowed eyesnavelnipple fetishnipple playnipple sucknipplesnudenude anthronude femalenudiston backopen mouthopen smilepantiespantsparent (lore)parent and daughter (lore)piercingplantigradepubespussyrabbitrecliningribsring piercingsalivasandalsshirtshoesshort hairshortssize differencesketch pageskinny anthroskinny femalesleep masksleepingsmilesneakerssolospandexspandex shortsspiked braceletspikesstandingsuckingswimwearswimwear asidet-shirttalking to anothertank toptenrectight bottomweartight clothingtight shortstoestonguetopweartriangle bikinitriotwo-piece swimsuitunderwearvaginal penetrationvisor capvulvawide eyedwingsyoungyoung anthroyoung female