Rule34 Scroller

Post #13286476

3264 × 2220
1boy, 1girls, after transformation, areolae, artist name, ass, ass bigger than head, ass expansion, ass focus, ass grab, ass shake, ax3lbravo, axlhearts, balls, belly, big ass, big breasts, big butt, big nipples, big penis, big thighs, bimbo, bimbofication, black hair, blowjob, blowjob face, blue eyes, blush, body transformation, bracelet, bracelets, breast expansion, breast grab, breast growth, breast growth (enlargement), breast squeeze, breast sucking, breasts, breasts bigger than head, breasts out, breath, cameltoe, child bearing hips, cleavage, clothed, clothed sex, clothing, color, comic, cum, cum in pussy, cum inside, curvy, dialogue, dress, dress shirt, drool, drooling, duo, earrings, ejaculation, embarrassed, english, english text, erect nipples, erect penis, erection, exposed breasts, exposed nipples, eyelashes, eyewear, female, female focus, female on top, feminine pose, feminization, figure transformation, floating heart, gender transformation, genderswap, genderswap (mtf), genital fluids, genitals, gigantic ass, gigantic breasts, gigantic penis, gigantic thighs, ginger, ginger hair, girly, grabbing, grey eyes, hair, hair growth, hairy, hairy balls, heart, heart symbol, heart-shaped pupils, hi res, hips, hips wider than shoulders, hourglass figure, huge ass, huge breasts, huge cock, huge nipples, identity death, lactation, large ass, large breasts, large penis, lips, lipstick, lipstick mark, lipstick on penis, long hair, male, male/female, milk, mind break, motion lines, mtf transformation, naked, naked female, navel, nipples, no bra, open mouth, oral, panties, part of a set, penetration, penis, phone, pink panties, post-transformation, precum, pubes, pubic hair, pussy, red hair, rule 63, saliva, sequence, sex, shiny, shiny hair, shiny skin, short hair, smile, speech bubble, spread legs, sweat, sweatdrop, sweating, teeth, text, thick, thick ass, thick thighs, thighs, tongue, tongue out, transformation, transformation sequence, vaginal penetration, voluptuous, voluptuous female, wide hips
406
Original Download

Artists

ax3lbravoaxlhearts

Metadata

colorcomicdialogueenglishenglish textgenderswapgenderswap (mtf)hi respart of a setrule 63sequencespeech bubbletext

Tags

1boy1girlsafter transformationareolaeartist nameassass bigger than headass expansionass focusass grabass shakeballsbellybig assbig breastsbig buttbig nipplesbig penisbig thighsbimbobimboficationblack hairblowjobblowjob faceblue eyesblushbody transformationbraceletbraceletsbreast expansionbreast grabbreast growthbreast growth (enlargement)breast squeezebreast suckingbreastsbreasts bigger than headbreasts outbreathcameltoechild bearing hipscleavageclothedclothed sexclothingcumcum in pussycum insidecurvydressdress shirtdrooldroolingduoearringsejaculationembarrassederect nippleserect peniserectionexposed breastsexposed nippleseyelasheseyewearfemalefemale focusfemale on topfeminine posefeminizationfigure transformationfloating heartgender transformationgenital fluidsgenitalsgigantic assgigantic breastsgigantic penisgigantic thighsgingerginger hairgirlygrabbinggrey eyeshairhair growthhairyhairy ballsheartheart symbolheart-shaped pupilshipships wider than shouldershourglass figurehuge asshuge breastshuge cockhuge nipplesidentity deathlactationlarge asslarge breastslarge penislipslipsticklipstick marklipstick on penislong hairmalemale/femalemilkmind breakmotion linesmtf transformationnakednaked femalenavelnipplesno braopen mouthoralpantiespenetrationpenisphonepink pantiespost-transformationprecumpubespubic hairpussyred hairsalivasexshinyshiny hairshiny skinshort hairsmilespread legssweatsweatdropsweatingteeththickthick assthick thighsthighstonguetongue outtransformationtransformation sequencevaginal penetrationvoluptuousvoluptuous femalewide hips