Post #12509134

11628 × 7324
absurd res, ahe gao, alien, alien humanoid, alley, animal genitalia, animal humanoid, animal penis, anthro, anthrofied, areola, ass, assimilation, athletic, bangs, baseball cap, bent over, big areola, big ass, big breasts, big butt, big penis, bloated, blush, bodily fluids, body horror, boots, bottomwear, breast expansion, breast grab, breast growth, breast growth (enlargement), breast squeeze, breast squish, breasts, breasts bigger than head, breasts out of clothes, broodmother, brown eyes, brown hair, butt expansion, cleavage, clitoris, close-up, clothed, clothed female, clothing, corruption, cum, cumshot, curves, curvy, curvy female, curvy figure, dissolving clothing, dripping, egg, egg laying, ejaculation, enormous penis, erect nipples, erection, erection under clothing, excessive cum, excessive genital fluids, expansion, exposed ass, exposed breasts, eye roll, eye through hair, eyeless, eyes rolling back, eyewear, female, fio germi, flat colors, footwear, forced, forced transformation, forked tongue, fti transformation, futa sans balls, futa transformation, futanari, gaping, gaping pussy, gastropod, gastropod humanoid, gender transformation, genital fluids, genitals, giant ass, glasses, green body, green nipples, green penis, green skin, grope, grotesque, growth, gun, hand on breast, hat, head transformation, headgear, headwear, herm, hi res, holding penis, huge ass, huge breasts, huge butt, human, humanoid, humanoid genitalia, humiliation, hybrid, identity death, ineffective clothing, intersex, jacket, kneeling, knock-kneed, larger female, larger intersex, legs, legs together, light body, light skin, long penis, long tongue, looking down, looking pleasured, looking up, lordburqan, lunate, macro, mammal, markings, masturbation, mature (disambiguation), mature female, medium breasts, messy, metal slug, mid-transformation, mind break, moan, mollusk, mollusk humanoid, monster, monster girl (genre), monsterification, mostly nude, mostly nude female, muscles, naked, naughty face, nipple outline, nipple slip, nipples, no bra, nude, nude female, nude futa, open mouth, outside, ovipositor, pale skin, partially clothed, penis, penis emerging from pussy, pink nipples, ponytail, precum, precum drip, precum string, precum through clothing, presenting, presenting breasts, presenting penis, puffy nipples, pussy, pussy juice drip, pussy to penis tf, queen, ranged weapon, round glasses, shaded, shirt, shoes, shorts, side boob, side ponytail, side view, size difference, skimpy, slerm, slim, slime, slug, slug humanoid, smaller female, smooth skin, solo anthro, solo focus, species transformation, spots, spotted body, squeezing, squish, straight hair, stroking (disambiguation), stroking penis, sweat, tank top, tentacle, thick lips, thick penis, thick thighs, tight clothing, tight fit, toned, toned female, tongue, tongue out, topwear, torn clothing, transformation, transformation sequence, translucent, translucent hair, under boob, vaginal fluids, vein, veiny muscles, veiny penis, vest, voluptuous, voluptuous female, voluptuous futa, weapon, wet, wet body, wet clothing, wet skin, white body, wide hips, wrist cuffs, wristband
508
Original Download Source

Artists

Characters

Copyrights

Metadata

Tags

ahe gaoalienalien humanoidalleyanimal genitaliaanimal humanoidanimal penisanthroanthrofiedareolaassassimilationathleticbangsbaseball capbent overbig areolabig assbig breastsbig buttbig penisbloatedblushbodily fluidsbody horrorbootsbottomwearbreast expansionbreast grabbreast growthbreast growth (enlargement)breast squeezebreast squishbreastsbreasts bigger than headbreasts out of clothesbroodmotherbrown eyesbrown hairbutt expansioncleavageclitorisclose-upclothedclothed femaleclothingcorruptioncumcumshotcurvescurvycurvy femalecurvy figuredissolving clothingdrippingeggegg layingejaculationenormous peniserect nippleserectionerection under clothingexcessive cumexcessive genital fluidsexpansionexposed assexposed breastseye rolleye through haireyelesseyes rolling backeyewearfemalefootwearforcedforced transformationforked tonguefti transformationfuta sans ballsfuta transformationfutanarigapinggaping pussygastropodgastropod humanoidgender transformationgenital fluidsgenitalsgiant assglassesgreen bodygreen nipplesgreen penisgreen skingropegrotesquegrowthgunhand on breasthathead transformationheadgearheadwearhermholding penishuge asshuge breastshuge butthumanhumanoidhumanoid genitaliahumiliationhybrididentity deathineffective clothingintersexjacketkneelingknock-kneedlarger femalelarger intersexlegslegs togetherlight bodylight skinlong penislong tonguelooking downlooking pleasuredlooking upmacromammalmarkingsmasturbationmature (disambiguation)mature femalemedium breastsmessymid-transformationmind breakmoanmolluskmollusk humanoidmonstermonster girl (genre)monsterificationmostly nudemostly nude femalemusclesnakednaughty facenipple outlinenipple slipnipplesno branudenude femalenude futaopen mouthoutsideovipositorpale skinpartially clothedpenispenis emerging from pussypink nipplesponytailprecumprecum dripprecum stringprecum through clothingpresentingpresenting breastspresenting penispuffy nipplespussypussy juice drippussy to penis tfqueenranged weaponround glassesshadedshirtshoesshortsside boobside ponytailside viewsize differenceskimpyslermslimslimeslugslug humanoidsmaller femalesmooth skinsolo anthrosolo focusspecies transformationspotsspotted bodysqueezingsquishstraight hairstroking (disambiguation)stroking penissweattank toptentaclethick lipsthick penisthick thighstight clothingtight fittonedtoned femaletonguetongue outtopweartorn clothingtransformationtransformation sequencetranslucenttranslucent hairunder boobvaginal fluidsveinveiny musclesveiny penisvestvoluptuousvoluptuous femalevoluptuous futaweaponwetwet bodywet clothingwet skinwhite bodywide hipswrist cuffswristband