Rule34 Scroller

Post #9600139

2160 × 3840
2023, 3d, 4k, 9:16, absurd res, accessory, ankh, anthro, anubian jackal, anubis, anubis (bom39), areola, arm markings, artist name, ass, big breasts, biped, black body, black hair, black nails, black sclera, bom39, breasts, canid, canine, canis, chain jewelry, chains, claws, colored nails, deity, egyptian, egyptian mythology, eye of horus, female, finger claws, floppyhuman, furgonomics, glistening, glistening breasts, goddess, gold (metal), gold chain, gold jewelry, gold markings, hair, hand on hip, hi res, hieroglyphics, huge breasts, jackal, jewelry, leg markings, light, lighting, looking at viewer, looking down, looking down at viewer, mammal, markings, mask, middle eastern mythology, mythology, nails, nipples, nude, portrait, pose, public domain, pupils, rear view, side boob, slit pupils, solo, solo anthro, tail, tail accessory, thick thighs, thigh markings, three-quarter portrait, three-quarter view, yellow eyes
168
Original Download Source

Artists

bom39floppyhuman

Characters

anubisanubis (bom39)

Copyrights

egyptian mythologymiddle eastern mythologymythology

Metadata

20233d4k9:16absurd resartist namehi resportraitpublic domainthree-quarter portrait

Tags

accessoryankhanthroanubian jackalareolaarm markingsassbig breastsbipedblack bodyblack hairblack nailsblack sclerabreastscanidcaninecanischain jewelrychainsclawscolored nailsdeityegyptianeye of horusfemalefinger clawsfurgonomicsglisteningglistening breastsgoddessgold (metal)gold chaingold jewelrygold markingshairhand on hiphieroglyphicshuge breastsjackaljewelryleg markingslightlightinglooking at viewerlooking downlooking down at viewermammalmarkingsmasknailsnipplesnudeposepupilsrear viewside boobslit pupilssolosolo anthrotailtail accessorythick thighsthigh markingsthree-quarter viewyellow eyes