Rule34 Scroller

Post #5178449

3104 × 3720
absurd res, anthro, archie comics, ass, avian, balls, bedroom eyes, belly, big ass, big belly, big breasts, big butt, bird, bodily fluids, body outline, breasts, canid, canine, clothing, cum, dialogue, digestion, english text, eyewear, face imprint, female, female pred, female prey, female/female, fox, foxynoms, genital fluids, genitals, glasses, goggles, hand imprint, hi res, imprint, infidelity, licking, licking lips, male, male/female, mammal, melody prower, miles tails prower, mina mongoose, multiple prey, narrowed eyes, oral vore, sally acorn, seductive, sega, sequence, sex, sonic (series), sonic riders, sonic the hedgehog (archie), sonic the hedgehog (comics), sonic the hedgehog (series), struggling, sweat, tails, tails the fox, text, tongue, tongue out, unwilling prey, vore, wave the swallow
83
Original Download Source

Artists

foxynoms

Characters

melody prowermiles tails prowermina mongoosesally acorntails the foxwave the swallow

Copyrights

archie comicssegasonic (series)sonic riderssonic the hedgehog (archie)sonic the hedgehog (comics)sonic the hedgehog (series)

Metadata

absurd resdialoguehi ressequence

Tags

anthroassavianballsbedroom eyesbellybig assbig bellybig breastsbig buttbirdbodily fluidsbody outlinebreastscanidcanineclothingcumdigestionenglish texteyewearface imprintfemalefemale predfemale preyfemale/femalefoxgenital fluidsgenitalsglassesgoggleshand imprintimprintinfidelitylickinglicking lipsmalemale/femalemammalmultiple preynarrowed eyesoral voreseductivesexstrugglingsweattailstexttonguetongue outunwilling preyvore