Post #14379135

4051 × 3403
alternate breast size, areola, bangs, bangs over one eye, big boobies, big boobs, big breasts, big tits, black dress, black hair, black lips, black lipstick, black mascara, black nail polish, blue eyes, boob, boobies, boobs, boobs bigger than head, boobs out, breast expansion, breast growth, breast growth (enlargement), breast milk, breast milk squirt, breast milk squirting, breasts, breasts bigger than head, breasts out, bursting out of clothing, cross ear piercing, cross ear ring, cross earring, cross earrings, dark areola, digital drawing (artwork), drool, drool on face, drool string, drooling, ear piercing, ear ring, earrings, elise culpepper, enormous boobs, enormous breasts, enormous tits, exclamation mark, exclamation point, expansion, expansion sound effects, fanart, fat boobs, fat breasts, fat tits, female, female focus, female only, fertility idol, fertility symbol, fimif, freckled face, freckles, freckles on breasts, freckles on chest, freckles on face, gigantic boobs, gigantic breasts, gigantic tits, goth, goth girl, goth makeup, huge boobs, huge breasts, hunter the parenting, hyper, hyper boobs, hyper breasts, hyper tits, inconvenient breasts, lactating, lactation, lactation through clothes, lactation without expressing, lactation without stimulation, light skin, light-skinned female, lipstick, magic, mascara, massive boobs, massive breasts, massive tits, milk, milk squirt, muffin top, nose piercing, nose ring, onomatopoeia, overweight, overweight female, pale skin, pale-skinned female, public domain, question mark, render, rendered, ripped clothes, ripped clothing, ripping clothing, septum piercing, septum ring, shadow, shadows, shocked, shocked expression, shocked eyes, solo, solo female, solo focus, sweat, sweatdrop, sweating, tearing clothes, tearing clothing, tits bigger than head, tits out, top heavy, venus body, venus of willendorf, venus symbol, voluptuous, voluptuous female, wardrobe malfunction, white skin, white teeth, world of darkness
204
Original Download Source

Artists

Characters

Copyrights

Metadata

Tags

alternate breast sizeareolabangsbangs over one eyebig boobiesbig boobsbig breastsbig titsblack dressblack hairblack lipsblack lipstickblack mascarablack nail polishblue eyesboobboobiesboobsboobs bigger than headboobs outbreast expansionbreast growthbreast growth (enlargement)breast milkbreast milk squirtbreast milk squirtingbreastsbreasts bigger than headbreasts outbursting out of clothingcross ear piercingcross ear ringcross earringcross earringsdark areoladrooldrool on facedrool stringdroolingear piercingear ringearringsenormous boobsenormous breastsenormous titsexclamation markexclamation pointexpansionexpansion sound effectsfat boobsfat breastsfat titsfemalefemale focusfemale onlyfertility idolfertility symbolfreckled facefrecklesfreckles on breastsfreckles on chestfreckles on facegigantic boobsgigantic breastsgigantic titsgothgoth girlgoth makeuphuge boobshuge breastshyperhyper boobshyper breastshyper titsinconvenient breastslactatinglactationlactation through clotheslactation without expressinglactation without stimulationlight skinlight-skinned femalelipstickmagicmascaramassive boobsmassive breastsmassive titsmilkmilk squirtmuffin topnose piercingnose ringoverweightoverweight femalepale skinpale-skinned femalequestion markripped clothesripped clothingripping clothingseptum piercingseptum ringshadowshadowsshockedshocked expressionshocked eyessolosolo femalesolo focussweatsweatdropsweatingtearing clothestearing clothingtits bigger than headtits outtop heavyvenus bodyvenus symbolvoluptuousvoluptuous femalewardrobe malfunctionwhite skinwhite teeth