Post #13646151

7784 × 7304
2025, 3 toes, 4 fingers, absurd res, all fours, anal, anus, ass, ass up, atlus, backsack, balls, ballsack, belly, big ass, big balls, big butt, big dom small sub, big ears, big penis, bite mark, black clothing, black headkerchief, black headwear, black kerchief, black neckerchief, black underwear, blue hair, bodily fluids, boone (misterimp), boots, bottom heavy, bottomwear, bracelet, claws, clenched teeth, clothed, clothing, clothing aside, crotch apron, crouching, cum, cum in ass, cum inside, cumshot, cutaway, dated, deep rimming, demon, diamond (artistjackalope), digital media (artwork), directed motion outline, dominant, drooling, drooling tongue, duo, dutch angle, ejaculation, emanata, erection, evil grin, excessive cum, excessive genital fluids, feet, finger claws, fingers, flash emanata, flesh fang, flying sweatdrops, footwear, foreskin, gem, genital fluids, genitals, gesture, gold (metal), gold jewelry, grabbing sheets, grey background, hair, half-closed eyes, half-erect, hand on another's butt, hand on ass, hand on butt, hands behind head, hat, headgear, headkerchief, headwear, heart symbol, hi res, hidden eyes, holding own penis, horn, horn grab, huge ass, huge balls, huge butt, huge cock, humanoid, humanoid genitalia, humanoid penis, imp, inflation, internal, internal anal, jack frost (megami tensei), jewelry, kerchief, kneeling, lap dance position, leaking precum, leg grab, lifting, loincloth, looking at another, looking at partner, looking through, looking through legs, lying, male, male/male, masturbation, megami tensei, moobs, mostly nude, motion lines, multiple positions, narrowed eyes, neckerchief, neckwear, nipples, on back, open mouth, open smile, oral, orgasm, pain, partially retracted foreskin, path lines, penile, penile masturbation, penis, pinned, pinned to wall, pointy ears, power bottom, precum, precum string, presenting, presenting hindquarters, prostate, prostate stimulation, purple balls, purple body, purple boots, purple clothing, purple footwear, purple hat, purple headwear, purple penis, purple skin, raised leg, raised leg grab, rear view, retracted foreskin, rimming, rough sex, ruff, saliva, saliva on anus, saliva on butt, saliva on face, sega, sequence, sex, sharp teeth, shoes, signature, simple background, size difference, smile, spade tail, standing, stomach bulge, sweat, sweatdrop, sweaty ass, sweaty belly, sweaty butt, sweaty legs, sweaty thighs, tail, tail boner, tail gesture, teeth, thin tail, three frame sequence, three-quarter view, throbbing, throbbing penis, toe claws, toes, tongue, tongue out, uncircumcised, underwear, underwear around ankle, underwear aside, underwear only, vein, veiny penis, wavy horn, white balls, white body, white penis, white skin, wyth
58
Original Download Source

Artists

Characters

Copyrights

Metadata

Tags

3 toes4 fingersall foursanalanusassass upbacksackballsballsackbellybig assbig ballsbig buttbig dom small subbig earsbig penisbite markblack clothingblack headkerchiefblack headwearblack kerchiefblack neckerchiefblack underwearblue hairbodily fluidsbootsbottom heavybottomwearbraceletclawsclenched teethclothedclothingclothing asidecrotch aproncrouchingcumcum in asscum insidecumshotcutawaydeep rimmingdemondiamond (artistjackalope)directed motion outlinedominantdroolingdrooling tongueduoejaculationemanataerectionevil grinexcessive cumexcessive genital fluidsfeetfinger clawsfingersflash emanataflesh fangflying sweatdropsfootwearforeskingemgenital fluidsgenitalsgesturegold (metal)gold jewelrygrabbing sheetsgrey backgroundhairhalf-closed eyeshalf-erecthand on another's butthand on asshand on butthands behind headhatheadgearheadkerchiefheadwearheart symbolhidden eyesholding own penishornhorn grabhuge asshuge ballshuge butthuge cockhumanoidhumanoid genitaliahumanoid penisimpinflationinternalinternal analjewelrykerchiefkneelinglap dance positionleaking precumleg grabliftingloinclothlooking at anotherlooking at partnerlooking throughlooking through legslyingmalemale/malemasturbationmoobsmostly nudemotion linesmultiple positionsnarrowed eyesneckerchiefneckwearnippleson backopen mouthopen smileoralorgasmpainpartially retracted foreskinpath linespenilepenile masturbationpenispinnedpinned to wallpointy earspower bottomprecumprecum stringpresentingpresenting hindquartersprostateprostate stimulationpurple ballspurple bodypurple bootspurple clothingpurple footwearpurple hatpurple headwearpurple penispurple skinraised legraised leg grabrear viewretracted foreskinrimmingrough sexruffsalivasaliva on anussaliva on buttsaliva on facesexsharp teethshoessignaturesize differencesmilespade tailstandingstomach bulgesweatsweatdropsweaty asssweaty bellysweaty buttsweaty legssweaty thighstailtail bonertail gestureteeththin tailthree frame sequencethree-quarter viewthrobbingthrobbing penistoe clawstoestonguetongue outuncircumcisedunderwearunderwear around ankleunderwear asideunderwear onlyveinveiny peniswavy hornwhite ballswhite bodywhite peniswhite skin