Rule34 Scroller

Post #13608888

3587 × 1027
2023, absurd res, anthro, armwear, balls, bandai namco, barcode, barcode tattoo, big breasts, bikini, bimbo anthro, bimbo lip, bimboaudino, bimbofication, black bikini top, black clothing, black latex, black legwear, black sclera, black thigh highs, black thong, black underwear, blonde hair, blue background, blue eyes, blush, border, breast expansion, breast growth, breast growth (enlargement), breasts, canid, canine, chest tuft, clothed, clothing, digimon, digimon (species), dipstick ears, dipstick tail, ear markings, english text, expansion, female, flaccid, fox, fur, gender transformation, genitals, glistening, glistening latex, growth, healslut, healslut 8 the renamon, hi res, huge breasts, human, human to anthro, humanoid genitalia, humanoid penis, intelligence loss, iq score, latex, latex armwear, latex bikini, latex clothing, latex legwear, latex thigh highs, latex thong, latex underwear, legwear, lips, male, mammal, markings, mtf transformation, multicolored ears, nipples, open mouth, penis, pink nipples, renamon, rubber clothing, sequence, simple background, skimpy, solo, species transformation, swimwear, tail, tail markings, tattoo, text, thick lips, thigh highs, thong, transformation, tuft, underwear, white body, white border, white fur, yellow body, yellow fur
66
Original Download Source

Artists

bimboaudino

Characters

digimon (species)renamon

Copyrights

bandai namcodigimon

Metadata

2023absurd resenglish texthi ressequencesimple backgroundtext

Tags

anthroarmwearballsbarcodebarcode tattoobig breastsbikinibimbo anthrobimbo lipbimboficationblack bikini topblack clothingblack latexblack legwearblack sclerablack thigh highsblack thongblack underwearblonde hairblue backgroundblue eyesblushborderbreast expansionbreast growthbreast growth (enlargement)breastscanidcaninechest tuftclothedclothingdipstick earsdipstick tailear markingsexpansionfemaleflaccidfoxfurgender transformationgenitalsglisteningglistening latexgrowthhealsluthealslut 8 the renamonhuge breastshumanhuman to anthrohumanoid genitaliahumanoid penisintelligence lossiq scorelatexlatex armwearlatex bikinilatex clothinglatex legwearlatex thigh highslatex thonglatex underwearlegwearlipsmalemammalmarkingsmtf transformationmulticolored earsnipplesopen mouthpenispink nipplesrubber clothingskimpysolospecies transformationswimweartailtail markingstattoothick lipsthigh highsthongtransformationtuftunderwearwhite bodywhite borderwhite furyellow bodyyellow fur