Rule34 Scroller

Post #12190251

2048 × 826
2025, abs, anal, anal sex, anthro, anthro on anthro, anthro penetrated, anthro penetrating, anthro penetrating anthro, anus, areola, armwear, ass, ass to mouth, backsack, balls, ballsack, bara, bareback, biceps, big areola, big ass, big butt, big muscles, big nipples, big pecs, big penis, bikini, blush, bodily fluids, bovid, bovine, breath, bubble ass, bubble butt, butt slap, butt squish, cattle, clenched teeth, clothed, clothed/nude, clothing, crouching, cum, cum expulsion, cum fart, cum from ass, cum in ass, cum in mouth, cum inside, cum on ground, cum splatter, cutaway, drooling, duo, ear piercing, ear ring, elbow gloves, emanata, erection, eye roll, eyebrows, facial piercing, feet, felid, flaccid, footwear, frosted flakes, fucked silly, fur, gay, gay male, genital fluids, genitals, glans, gloves, hand on head, handwear, heart symbol, hi res, horn, huge ass, huge butt, huge cock, huge muscles, huge pecs, humanoid feet, humanoid genitalia, humanoid penis, impregnation, ineffective clothing, internal, irrumatio, kd gai, kellogg's, kemono, kerchief, kissing, leash, leash pull, legwear, looking pleasured, lying, male, male impregnating male, male impregnation, male only, male penetrated, male penetrating, male penetrating male, male pregnancy, male/male, mammal, mankini, mascot, motion lines, multiple scenes, muscles, muscular, muscular anthro, muscular male, navel, neckerchief, neckwear, nipple fetish, nipple pinch, nipple play, nipple pull, nipples, nose piercing, nose ring, nose ring pull, nude, on front, one-piece swimsuit, open mouth, oral, oral penetration, orgasm, pantherine, pec squish, pecs, penetration, penile, penile penetration, penis, penis in ass, penis in face, penis in mouth, penis size difference, piercing, piercing pull, pinch, pink mankini, plantigrade, pregnancy, pregnant, pregnant male, ring piercing, rough sex, saliva, sequence, sex, simple background, sitting, slap, sling bikini, socks, soles, spanking, sperm cell, squish, standing, sweat, swimwear, tattoo, teeth, thick arms, thick penis, thick thighs, thigh highs, thigh socks, tiger, tony the tiger, tuft, two-piece swimsuit, uterus, vein, veiny penis, white mankini, yaoi
234
Original Download Source

Artists

kd gai

Characters

tony the tiger

Copyrights

frosted flakeskellogg's

Metadata

2025hi resmultiple scenessequencesimple background

Tags

absanalanal sexanthroanthro on anthroanthro penetratedanthro penetratinganthro penetrating anthroanusareolaarmwearassass to mouthbacksackballsballsackbarabarebackbicepsbig areolabig assbig buttbig musclesbig nipplesbig pecsbig penisbikiniblushbodily fluidsbovidbovinebreathbubble assbubble buttbutt slapbutt squishcattleclenched teethclothedclothed/nudeclothingcrouchingcumcum expulsioncum fartcum from asscum in asscum in mouthcum insidecum on groundcum splattercutawaydroolingduoear piercingear ringelbow glovesemanataerectioneye rolleyebrowsfacial piercingfeetfelidflaccidfootwearfucked sillyfurgaygay malegenital fluidsgenitalsglansgloveshand on headhandwearheart symbolhornhuge asshuge butthuge cockhuge muscleshuge pecshumanoid feethumanoid genitaliahumanoid penisimpregnationineffective clothinginternalirrumatiokemonokerchiefkissingleashleash pulllegwearlooking pleasuredlyingmalemale impregnating malemale impregnationmale onlymale penetratedmale penetratingmale penetrating malemale pregnancymale/malemammalmankinimascotmotion linesmusclesmuscularmuscular anthromuscular malenavelneckerchiefneckwearnipple fetishnipple pinchnipple playnipple pullnipplesnose piercingnose ringnose ring pullnudeon frontone-piece swimsuitopen mouthoraloral penetrationorgasmpantherinepec squishpecspenetrationpenilepenile penetrationpenispenis in asspenis in facepenis in mouthpenis size differencepiercingpiercing pullpinchpink mankiniplantigradepregnancypregnantpregnant malering piercingrough sexsalivasexsittingslapsling bikinisockssolesspankingsperm cellsquishstandingsweatswimweartattooteeththick armsthick penisthick thighsthigh highsthigh sockstigertufttwo-piece swimsuituterusveinveiny peniswhite mankiniyaoi