Rule34 Scroller

Post #10480689

1024 × 1536
1girls, ai generated, ass, athletic, athletic female, big areola, big ass, big breasts, big female, big girl, black hair, blush, breasts, brown hair, curvy, curvy figure, cute, cute face, detailed, dinixdream, disney, esmeralda, eyelashes, eyeshadow, female, female focus, female only, fit, fit female, focus, girly, green eyes, high quality, legs, light skin, light-skinned female, lips, lipstick, literature, looking at viewer, makeup, mascara, mature, midriff, milf, naked, navel, nipples, nude, older female, patreon, patreon username, petite, pool, poolside, posing, princess, public, public domain, public exposure, public nudity, pussy, seductive, seductive look, slim, stable diffusion, standing, tagme, teenager, the hunchback of notre dame, thick ass, thick butt, thick thighs, thighs, topless, topless female, young, younger female
141
Original Download

Artists

dinixdream

Characters

esmeralda

Copyrights

disneypatreonthe hunchback of notre dame

Metadata

ai generatedhigh qualityliteraturepublic domainstable diffusiontagme

Tags

1girlsassathleticathletic femalebig areolabig assbig breastsbig femalebig girlblack hairblushbreastsbrown haircurvycurvy figurecutecute facedetailedeyelasheseyeshadowfemalefemale focusfemale onlyfitfit femalefocusgirlygreen eyeslegslight skinlight-skinned femalelipslipsticklooking at viewermakeupmascaramaturemidriffmilfnakednavelnipplesnudeolder femalepatreon usernamepetitepoolpoolsideposingprincesspublicpublic exposurepublic nuditypussyseductiveseductive lookslimstandingteenagerthick assthick buttthick thighsthighstoplesstopless femaleyoungyounger female